Best SellerRecombinant 83-amino-acid IGF-1 analogue with Arg³ substitution and N-terminal extension, for in vitro research.
Purity
99%+
CAS Number
946870-92-4
Status
In Stock
Dispatch
Same-Day (before 2pm)
Select Size
£199.99
Research verification required. All orders are reviewed before dispatch. You will receive an email confirmation and a WhatsApp or phone call within 60 minutes to verify your research purpose.
IGF-1 LR3 (Long Arg³ Insulin-like Growth Factor-1) is a recombinant 83-amino-acid analogue of human IGF-1 with an arginine substitution at position 3 and a 13-amino-acid N-terminal extension. It has been investigated in preclinical research for its reduced affinity to IGF binding proteins and extended bioactive half-life. Supplied as lyophilised powder for in vitro laboratory research only.
| Compound Name | IGF-1 LR3 |
| Category | Growth & Muscle |
| CAS Number | 946870-92-4 |
| Molecular Weight | 9117.6 g/mol |
| Molecular Formula | C₄₀₀H₆₂₅N₁₁₁O₁₁₅S₉ |
| Sequence | MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA |
| Purity | ≥99%+ (HPLC) |
| Form | Lyophilised powder |
| Storage | Store lyophilised at -20°C. Protect from light. Reconstituted: aliquot and store at -80°C. Use within 30 days of reconstitution. |
| Reconstitution | Reconstitute in sterile 0.6% acetic acid or bacteriostatic water (pH-adjusted). Typical stock concentration: 1 mg/mL. |
Every order of IGF-1 LR3 includes a batch-specific CoA with HPLC chromatogram, mass spectrometry data, and laboratory accreditation details.
A recombinant 83-amino-acid IGF-1 analogue investigated in preclinical research for its role in IGF-1 receptor signalling with reduced binding-protein affinity.
99%+, confirmed by independent third-party HPLC analysis. Batch-specific CoA included.
No. Supplied for in vitro laboratory research only. Not a licensed medicine.
IGF-1 LR3 is supplied by Premio Peptides (BELL RED LIMITED) exclusively for in vitro laboratory research. It is not a licensed medicine, is not approved for human or veterinary use, and must not be administered to any living organism outside a formally approved research protocol. Purchasers assume full responsibility for compliance with applicable regulations.